Structure of PDB 8t8c Chain 1V

Receptor sequence

>8t8c1V (length=101) Species: 300852 (Thermus thermophilus HB8)

MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGGEKTVVGTP
VVEGASVVAEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEIR
G

3D structure

• PDB: 8t8c Practical Synthesis of N -Formylmethionylated Peptidyl-tRNA Mimics.
• Chain: 1V
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1V	G8 G9 K10 L18 K19 E23 K24 R66 K69 V72 K74 F75 K76 A77 K78 V79 Y81 R83 K84 K85 G86 H87 Q89	G8 G9 K10 L18 K19 E23 K24 R66 K69 V72 K74 F75 K76 A77 K78 V79 Y81 R83 K84 K85 G86 H87 Q89
BS02	MG	1V	K78 Q80	K78 Q80
BS03	MG	1V	F75 K76 Q80 Y81 R82	F75 K76 Q80 Y81 R82
BS04	MG	1V	E23 K24 P90 Y91	E23 K24 P90 Y91
BS05	MG	1V	T7 G9	T7 G9

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8t8c, PDBe:8t8c, PDBj:8t8c
• PDBsum: 8t8c
• PubMed: 37433044
• UniProt: P60492|RL21_THET8 Large ribosomal subunit protein bL21 (Gene Name=rplU)