Structure of PDB 5wit Chain 1U

Receptor sequence

>5wit1U (length=116) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRK
RRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVR
EPQVFAELVERAKAAQ

3D structure

PDB

5wit Co-produced natural ketolides methymycin and pikromycin inhibit bacterial growth by preventing synthesis of a limited number of proteins.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	1U	P2 R3 A4 K5 T6 G7 V8 R10 R11 R12 K13 H14 K15 K16 K19 K22 G23 Y24 W25 G26 L27 R28 K30 S31 F32 R33 K34 R36 E37 Y45 Y47 H49 R50 K51 R52 R53 K54 R55 F57 R58 R59 W61 I62 N66 R70 N75 Y76 S77 H81 D91 R92	P1 R2 A3 K4 T5 G6 V7 R9 R10 R11 K12 H13 K14 K15 K18 K21 G22 Y23 W24 G25 L26 R27 K29 S30 F31 R32 K33 R35 E36 Y44 Y46 H48 R49 K50 R51 R52 K53 R54 F56 R57 R58 W60 I61 N65 R69 N74 Y75 S76 H80 D90 R91
BS02	MG	1U	G26 K30	G25 K29
BS03	MG	1U	G7 R10 R11	G6 R9 R10
BS04	MG	1U	K5 G7	K4 G6
BS05	MG	1U	D97 R101	D96 R100
BS06	MG	1U	K22 S29	K21 S28
BS07	MG	1U	F40 G43 N44	F39 G42 N43
BS08	MG	1U	G43 R50	G42 R49

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5wit, PDBe:5wit, PDBj:5wit
PDBsum	5wit
PubMed	28934499
UniProt	P60491\|RL20_THET8 Large ribosomal subunit protein bL20 (Gene Name=rplT)