Structure of PDB 8uet Chain 1T |
>8uet1T (length=85) Species: 9823 (Sus scrofa) [Search protein sequence] |
PPLTLEAIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMA MEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE |
|
PDB | 8uet High-resolution in situ structures of mammalian respiratory supercomplexes. |
Chain | 1T |
Resolution | 3.7 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
EHZ |
1T |
D43 S44 L45 |
D40 S41 L42 |
|
|
|
|