Structure of PDB 6o97 Chain 1T

Receptor sequence

>6o971T (length=131) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAA

3D structure

PDB

6o97 Design, Multigram Synthesis, and in Vitro and in Vivo Evaluation of Propylamycin: A Semisynthetic 4,5-Deoxystreptamine Class Aminoglycoside for the Treatment of Drug-Resistant Enterobacteriaceae and Other Gram-Negative Pathogens.

Chain

Resolution

2.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1T	N2 R3 G4 R23 R51 R53 R54 N55 N58 T60 I75 R93 R95 R96 A97 K98 Y100 F101 K113 K119	N2 R3 G4 R23 R51 R53 R54 N55 N58 T60 I75 R93 R95 R96 A97 K98 Y100 F101 K113 K119
BS02	rna	1T	E36 R39 R41 S106 D107 R108 R111 R118 K119 D122	E36 R39 R41 S106 D107 R108 R111 R118 K119 D122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6o97, PDBe:6o97, PDBj:6o97
PDBsum	6o97
PubMed	30793894
UniProt	P60490\|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]