Structure of PDB 6cfj Chain 1T

Receptor sequence
>6cfj1T (length=131) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAA
3D structure
PDB6cfj Binding and Action of Amino Acid Analogs of Chloramphenicol upon the Bacterial Ribosome.
Chain1T
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1T N2 R3 G4 R23 R51 R53 R54 N55 N58 I75 R95 R96 A97 K98 Y100 F101 K113 K119 N2 R3 G4 R23 R51 R53 R54 N55 N58 I75 R95 R96 A97 K98 Y100 F101 K113 K119
BS02 rna 1T E36 R39 D107 R108 R111 R118 K119 D122 E36 R39 D107 R108 R111 R118 K119 D122
BS03 MG 1T D117 K119 D117 K119
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cfj, PDBe:6cfj, PDBj:6cfj
PDBsum6cfj
PubMed29410130
UniProtP60490|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]