Structure of PDB 7rqc Chain 1S

Receptor sequence

>7rqc1S (length=110) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

3D structure

PDB

7rqc Structural basis for the context-specific action of the classic peptidyl transferase inhibitor chloramphenicol.

Chain

Resolution

2.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1S	R3 R9 R10 F12 R13 N16 R17 I18 T21 R23 R89 Y94 R106 F112	R1 R7 R8 F10 R11 N14 R15 I16 T19 R21 R87 Y92 R104 F110
BS02	rna	1S	R15 K19 R25 F29 R30 S31 L32 H34 Y36 Q38 G45 V46 T47 S50 L54 N61 K62 T63 K93 H95 G96 R97	R13 K17 R23 F27 R28 S29 L30 H32 Y34 Q36 G43 V44 T45 S48 L52 N59 K60 T61 K91 H93 G94 R95

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7rqc, PDBe:7rqc, PDBj:7rqc
PDBsum	7rqc
PubMed	35165455
UniProt	Q5SHQ4\|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)