Structure of PDB 8vtu Chain 1R

Receptor sequence

>8vtu1R (length=118) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDH
LIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKL
AERRRGDGAPLALVELVE

3D structure

PDB

8vtu Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.4 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	1R	M1 R2 H3 L4 K5 S6 R8 K9 L10 N11 R12 H13 S14 S15 H16 R17 L20 R22 N23 Q24 K26 S27 H31 I34 T35 T36 T37 P39 K40 K42 R45 D49 H50 H53 R57 L60 H61 R63 R64 R68 Q71 R77 R90 Q91 G92 G93 R96 K99 R104 R105 G106 D107	M1 R2 H3 L4 K5 S6 R8 K9 L10 N11 R12 H13 S14 S15 H16 R17 L20 R22 N23 Q24 K26 S27 H31 I34 T35 T36 T37 P39 K40 K42 R45 D49 H50 H53 R57 L60 H61 R63 R64 R68 Q71 R77 R90 Q91 G92 G93 R96 K99 R104 R105 G106 D107
BS02	MG	1R	R105 G106	R105 G106
BS03	MG	1R	N23 Q24	N23 Q24

External links

PDB	RCSB:8vtu, PDBe:8vtu, PDBj:8vtu
PDBsum	8vtu
PubMed	39039256
UniProt	Q9Z9H5\|RL17_THET8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)