Structure of PDB 8ueq Chain 1R |
>8ueq1R (length=96) Species: 9823 (Sus scrofa) [Search protein sequence] |
GVRTSPTGEKVTHTGQAYDDGDYRRVRFSDRQKEVNENFAIDLIAEQPVS EVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQPHH |
|
PDB | 8ueq High-resolution in situ structures of mammalian respiratory supercomplexes. |
Chain | 1R |
Resolution | 3.4 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
1R |
H68 C84 C87 |
H68 C84 C87 |
|
|
|
|