Structure of PDB 5v8i Chain 1R

Receptor sequence

>5v8i1R (length=118) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDH
LIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKL
AERRRGDGAPLALVELVE

3D structure

PDB

5v8i Structural robustness of the ribosome inferred from X-ray crystal structures of the 30S ribosomal subunit and the 70S ribosome lacking ribosomal protein uS17

Chain

Resolution

3.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	1R	M1 R2 H3 L4 K5 S6 R8 K9 N11 R12 H13 S14 S15 H16 R17 L20 R22 N23 Q24 K26 H31 T35 T36 P39 K40 K42 R45 D49 H50 H53 R57 L60 H61 R63 R64 L67 R68 Q71 R77 R90 Q91 G92 G93 R96 K99 R104 R105 G106 D107	M1 R2 H3 L4 K5 S6 R8 K9 N11 R12 H13 S14 S15 H16 R17 L20 R22 N23 Q24 K26 H31 T35 T36 P39 K40 K42 R45 D49 H50 H53 R57 L60 H61 R63 R64 L67 R68 Q71 R77 R90 Q91 G92 G93 R96 K99 R104 R105 G106 D107
BS02	MG	1R	M1 H3	M1 H3
BS03	MG	1R	R105 G106	R105 G106
BS04	MG	1R	L98 K99	L98 K99

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5v8i, PDBe:5v8i, PDBj:5v8i
PDBsum	5v8i
PubMed
UniProt	Q72I33\|RL17_THET2 Large ribosomal subunit protein bL17 (Gene Name=rplQ)

[Back to BioLiP]