Structure of PDB 7rq9 Chain 1O

Receptor sequence

>7rq91O (length=122) Species: 300852 (Thermus thermophilus HB8)

MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRG
AVKEGDVVKAVVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFG
PVARELREKGFMKIVSLAPEVL

3D structure

• PDB: 7rq9 A synthetic antibiotic class overcoming bacterial multidrug resistance.
• Chain: 1O
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1O	M1 Q3 Q5 T6 Y7 I22 R23 K26 G27 S28 N29 A30 K31 Y32 V40 S42 K44 K66 K67 E68 K70	M1 Q3 Q5 T6 Y7 I22 R23 K26 G27 S28 N29 A30 K31 Y32 V40 S42 K44 K66 K67 E68 K70
BS02	rna	1O	N13 P48 R49 T96 R97 F99 R107	N13 P48 R49 T96 R97 F99 R107
BS03	MG	1O	R49 K53	R49 K53
BS04	MG	1O	D12 I86 R94	D12 I86 R94

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7rq9, PDBe:7rq9, PDBj:7rq9
• PDBsum: 7rq9
• PubMed: 34707295
• UniProt: Q5SHP8|RL14_THET8 Large ribosomal subunit protein uL14 (Gene Name=rplN)