Structure of PDB 6xqd Chain 1O

Receptor sequence

>6xqd1O (length=122) Species: 300852 (Thermus thermophilus HB8)

MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRG
AVKEGDVVKAVVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFG
PVARELREKGFMKIVSLAPEVL

3D structure

• PDB: 6xqd Sarecycline interferes with tRNA accommodation and tethers mRNA to the 70S ribosome.
• Chain: 1O
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1O	M1 Q3 Q5 T6 Y7 I22 R23 L25 G27 S28 N29 K31 Y32 S42 K44 V57 K66 K67 E68 K70 R78 N82	M1 Q3 Q5 T6 Y7 I22 R23 L25 G27 S28 N29 K31 Y32 S42 K44 V57 K66 K67 E68 K70 R78 N82
BS02	rna	1O	N13 P48 R49 T96 R97 R107	N13 P48 R49 T96 R97 R107
BS03	MG	1O	D12 I86 P93	D12 I86 P93
BS04	MG	1O	R17 F99	R17 F99

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xqd, PDBe:6xqd, PDBj:6xqd
• PDBsum: 6xqd
• PubMed: 32817463
• UniProt: Q5SHP8|RL14_THET8 Large ribosomal subunit protein uL14 (Gene Name=rplN)