Structure of PDB 6czr Chain 1N

Receptor sequence

>6czr1N (length=140) Species: 300852 (Thermus thermophilus HB8)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV

3D structure

• PDB: 6czr Unifying the Aminohexopyranose- and Peptidyl-Nucleoside Antibiotics: Implications for Antibiotic Design
• Chain: 1N
• Resolution: 3.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1N	T3 V5 L23 G24 R25 T28 R35 K37 N45 F51 T63 K65 K66 Q69 K70 Y72 R74 Y75 S76 Y78 P79 G80 L82 H94 E100 A102 G105 M106 P108 P111 L112 R114 K118 H130	T3 V5 L23 G24 R25 T28 R35 K37 N45 F51 T63 K65 K66 Q69 K70 Y72 R74 Y75 S76 Y78 P79 G80 L82 H94 E100 A102 G105 M106 P108 P111 L112 R114 K118 H130
BS02	MG	1N	V62 T63	V62 T63
BS03	MG	1N	L34 G49	L34 G49

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6czr, PDBe:6czr, PDBj:6czr
• PDBsum: 6czr
• UniProt: P60488|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)