Structure of PDB 7ymm Chain 1K

Receptor sequence
>7ymm1K (length=37) Species: 329726 (Acaryochloris marina MBIC11017) [Search protein sequence]
KLPEAFSVFSPIVDVMPVIPLFFLALAFVWQAAVGFK
3D structure
PDB7ymm Structure of a large photosystem II supercomplex from Acaryochloris marina.
Chain1K
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CL7 1K P25 L29 P17 L21
BS02 CL7 1K W38 Q39 W30 Q31
BS03 8CT 1K M24 I27 F30 V37 M16 I19 F22 V29
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ymm, PDBe:7ymm, PDBj:7ymm
PDBsum7ymm
PubMed38394197
UniProtB0C6Z7|PSBK_ACAM1 Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]