Structure of PDB 8vtu Chain 1G

Receptor sequence

>8vtu1G (length=181) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

PDB

8vtu Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	1G	V38 N40 G42 L43 E45 K47 T71 A73 K74 K75 I77 N79 F80 I88 S124 D126 R128 N132 L135 G154 M155 D156	V37 N39 G41 L42 E44 K46 T70 A72 K73 K74 I76 N78 F79 I87 S123 D125 R127 N131 L134 G153 M154 D155
BS02	rna	1G	P2 N27 W29 E30 Q66 K67 A69 V70 R91 V92 T93 R95 R96 R98	P1 N26 W28 E29 Q65 K66 A68 V69 R90 V91 T92 R94 R95 R97
BS03	rna	1G	S76 S78	S75 S77
BS04	MG	1G	R128 G129 N130 T161	R127 G128 N129 T160

External links

PDB	RCSB:8vtu, PDBe:8vtu, PDBj:8vtu
PDBsum	8vtu
PubMed	39039256
UniProt	Q5SHQ0\|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]