Structure of PDB 7rqc Chain 1G

Receptor sequence

>7rqc1G (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 7rqc Structural basis for the context-specific action of the classic peptidyl transferase inhibitor chloramphenicol.
• Chain: 1G
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1G	K36 V38 N40 L43 G44 E45 T71 A73 K74 K75 I77 N79 F80 L82 I88 S124 D126 R128 N130 N132 G134 L135 R136 R153 G154 D156 A158	K35 V37 N39 L42 G43 E44 T70 A72 K73 K74 I76 N78 F79 L81 I87 S123 D125 R127 N129 N131 G133 L134 R135 R152 G153 D155 A157
BS02	rna	1G	P2 N27 V28 W29 E30 Q66 K67 A69 V70 R91 V92 T93 R95 R96 R98	P1 N26 V27 W28 E29 Q65 K66 A68 V69 R90 V91 T92 R94 R95 R97
BS03	MG	1G	F141 P142	F140 P141
BS04	MG	1G	N130 T161	N129 T160

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7rqc, PDBe:7rqc, PDBj:7rqc
• PDBsum: 7rqc
• PubMed: 35165455
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)