Structure of PDB 5v8i Chain 1G

Receptor sequence

>5v8i1G (length=181) Species: 262724 (Thermus thermophilus HB27)

PLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 5v8i Structural robustness of the ribosome inferred from X-ray crystal structures of the 30S ribosomal subunit and the 70S ribosome lacking ribosomal protein uS17
• Chain: 1G
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1G	K36 V38 N40 L43 E45 T71 A73 K75 I77 F80 I88 R91 S124 F125 D126 R128 N132 L133 G134 L135 G154 M155 D156	K35 V37 N39 L42 E44 T70 A72 K74 I76 F79 I87 R90 S123 F124 D125 R127 N131 L132 G133 L134 G153 M154 D155
BS02	rna	1G	P2 N27 W29 Q66 K67 V70 R91 V92 T93 R95 R96 R98	P1 N26 W28 Q65 K66 V69 R90 V91 T92 R94 R95 R97
BS03	MG	1G	L139 F141 I144	L138 F140 I143
BS04	MG	1G	N123 F125	N122 F124
BS05	MG	1G	R128 N130	R127 N129

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5v8i, PDBe:5v8i, PDBj:5v8i
• PDBsum: 5v8i
• UniProt: Q72I16|RL5_THET2 Large ribosomal subunit protein uL5 (Gene Name=rplE)