Structure of PDB 5doy Chain 1G

Receptor sequence

>5doy1G (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 5doy Distinct tRNA Accommodation Intermediates Observed on the Ribosome with the Antibiotics Hygromycin A and A201A.
• Chain: 1G
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1G	K36 V38 N40 G42 L43 E45 K47 T71 R72 A73 K74 K75 I77 N79 F80 I88 R91 S124 D126 R128 N132 L133 G134 L135 G154 M155 D156	K35 V37 N39 G41 L42 E44 K46 T70 R71 A72 K73 K74 I76 N78 F79 I87 R90 S123 D125 R127 N131 L132 G133 L134 G153 M154 D155
BS02	rna	1G	P2 N27 W29 E30 Q66 K67 A69 V70 R91 V92 T93 R95 R96 R98	P1 N26 W28 E29 Q65 K66 A68 V69 R90 V91 T92 R94 R95 R97
BS03	rna	1G	S76 S78	S75 S77
BS04	MG	1G	G129 N130 T161	G128 N129 T160
BS05	MG	1G	L139 F141 P142 I144	L138 F140 P141 I143

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5doy, PDBe:5doy, PDBj:5doy
• PDBsum: 5doy
• PubMed: 26028538
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)