Structure of PDB 9b00 Chain 1F

Receptor sequence

>9b001F (length=203) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

VYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRG
EVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV
RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVL
LVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNR
IGG

3D structure

PDB

9b00 Berberine analog of chloramphenicol exhibits a distinct mode of action and unveils ribosome plasticity.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	1F	H31 L32 W34 E35 R38 Q40 L41 R44 R45 R46 T48 A49 S50 T51 K52 T53 R54 G55 V57 A58 Y59 S60 G61 R62 K63 Q67 K68 H69 G71 R72 A73 R74 H75 G76 P81 I82 F83 V84 G85 V89 F90 P92 P94 R95 Y99 T100 P102 K103 K104 R106 K108 G134 K135 T136 R165 R168 N169 P171 L176 E179 G180 Y184 R205	H26 L27 W29 E30 R33 Q35 L36 R39 R40 R41 T43 A44 S45 T46 K47 T48 R49 G50 V52 A53 Y54 S55 G56 R57 K58 Q62 K63 H64 G66 R67 A68 R69 H70 G71 P76 I77 F78 V79 G80 V84 F85 P87 P89 R90 Y94 T95 P97 K98 K99 R101 K103 G129 K130 T131 R160 R163 N164 P166 L171 E174 G175 Y179 R200
BS02	MG	1F	G61 R62	G56 R57
BS03	MG	1F	S50 T51	S45 T46
BS04	MG	1F	R72 A73	R67 A68
BS05	MG	1F	G76 D77	G71 D72
BS06	MG	1F	A58 Y59	A53 Y54
BS07	MG	1F	L170 V173	L165 V168
BS08	MG	1F	K63 W65 P66 H75	K58 W60 P61 H70
BS09	MG	1F	R54 D77 G79	R49 D72 G74
BS10	MG	1F	R164 T175	R159 T170

External links

PDB	RCSB:9b00, PDBe:9b00, PDBj:9b00
PDBsum	9b00
PubMed	39019034
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]