Structure of PDB 8uev Chain 1F

Receptor sequence

>8uev1F (length=432) Species: 9823 (Sus scrofa)

PKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWI
LGEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCK
DREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREA
YEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLK
PPFPADVGVFGCPTTVANVETVAVSPTICRRGGAWFASFGRERNSGTKLF
NISGHVNHPCTVEEEMSVPLKELIEKHAGGVIGGWDNLLAVIPGGSSTPL
IPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKH
ESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIEGHTICA
LGDGAAWPVQGLIRHFRPELEERMQQFALQHQ

3D structure

• PDB: 8uev High-resolution in situ structures of mammalian respiratory supercomplexes.
• Chain: 1F
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	1F	G67 R68 G69 K78 N96 D98 E99 Y184 G187 E188 E189 A223 N224 A406 L407	G61 R62 G63 K72 N90 D92 E93 Y178 G181 E182 E183 A217 N218 A400 L401
BS02	SF4	1F	P203 C359 G360 Q361 C362 C365 T403 I404 C405 L407	P197 C353 G354 Q355 C356 C359 T397 I398 C399 L401

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0046872 metal ion binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:0042775 mitochondrial ATP synthesis coupled electron transport
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005829 cytosol
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:8uev, PDBe:8uev, PDBj:8uev
• PDBsum: 8uev
• PubMed: 38811722
• UniProt: A0A4X1SZP7