Structure of PDB 5v8i Chain 1F

Receptor sequence

>5v8i1F (length=202) Species: 262724 (Thermus thermophilus HB27)

VYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRG
EVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV
RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVL
LVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNR
IG

3D structure

• PDB: 5v8i Structural robustness of the ribosome inferred from X-ray crystal structures of the 30S ribosomal subunit and the 70S ribosome lacking ribosomal protein uS17
• Chain: 1F
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1F	N29 H31 W34 E35 R38 Q40 L41 K43 R44 R45 R46 T48 A49 S50 T51 T53 R54 G55 V57 A58 Y59 S60 R62 K63 Q67 K68 H69 R72 R74 H75 G76 I82 F83 V84 G85 V89 F90 P92 P94 Y99 T100 P102 K103 K104 R106 K108 G134 K135 T136 R165 R168 N169 P171 G180 Y184 R205	N24 H26 W29 E30 R33 Q35 L36 K38 R39 R40 R41 T43 A44 S45 T46 T48 R49 G50 V52 A53 Y54 S55 R57 K58 Q62 K63 H64 R67 R69 H70 G71 I77 F78 V79 G80 V84 F85 P87 P89 Y94 T95 P97 K98 K99 R101 K103 G129 K130 T131 R160 R163 N164 P166 G175 Y179 R200
BS02	MG	1F	H75 G76 D77	H70 G71 D72
BS03	MG	1F	L170 V173	L165 V168
BS04	MG	1F	G87 V88	G82 V83
BS05	MG	1F	T51 K52	T46 K47
BS06	MG	1F	Y59 S60 D77	Y54 S55 D72
BS07	MG	1F	R54 D77	R49 D72

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5v8i, PDBe:5v8i, PDBj:5v8i
• PDBsum: 5v8i
• UniProt: Q72I05|RL4_THET2 Large ribosomal subunit protein uL4 (Gene Name=rplD)