Structure of PDB 5hcr Chain 1F

Receptor sequence

>5hcr1F (length=202) Species: 300852 (Thermus thermophilus HB8)

VYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRG
EVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV
RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVL
LVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNR
IG

3D structure

• PDB: 5hcr Structures of proline-rich peptides bound to the ribosome reveal a common mechanism of protein synthesis inhibition.
• Chain: 1F
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1F	N29 H31 L32 W34 E35 R38 Q40 L41 A42 K43 R44 R45 R46 T48 A49 S50 T51 T53 R54 G55 A58 Y59 S60 G61 R62 K63 Q67 K68 H69 G71 R72 R74 H75 G76 P81 I82 F83 V84 G85 V88 V89 F90 P92 P94 R95 Y99 T100 P102 K103 K104 V105 R106 G134 K135 T136 R165 R168 N169 L170 P171 L176 G180 Y184 R205	N24 H26 L27 W29 E30 R33 Q35 L36 A37 K38 R39 R40 R41 T43 A44 S45 T46 T48 R49 G50 A53 Y54 S55 G56 R57 K58 Q62 K63 H64 G66 R67 R69 H70 G71 P76 I77 F78 V79 G80 V83 V84 F85 P87 P89 R90 Y94 T95 P97 K98 K99 V100 R101 G129 K130 T131 R160 R163 N164 L165 P166 L171 G175 Y179 R200
BS02	MG	1F	R72 A73	R67 A68
BS03	MG	1F	Q67 K68	Q62 K63
BS04	MG	1F	R54 P81	R49 P76
BS05	MG	1F	G76 D77	G71 D72
BS06	MG	1F	R168 L170	R163 L165
BS07	MG	1F	K63 W65 P66 R74 H75	K58 W60 P61 R69 H70

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5hcr, PDBe:5hcr, PDBj:5hcr
• PDBsum: 5hcr
• PubMed: 26809677
• UniProt: Q5SHN9|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)