Structure of PDB 8ugp Chain 1C

Receptor sequence
>8ugp1C (length=53) Species: 9823 (Sus scrofa) [Search protein sequence]
DTWYEIDMRILTGYGFHPFRKFPLSGYVELRYDRVVAEPVELAQEFRKFD
LNS
3D structure
PDB8ugp High-resolution in situ structures of mammalian respiratory supercomplexes.
Chain1C
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide 1C E193 F197 D198 S201 E45 F49 D50 S53
BS02 peptide 1C P167 Y171 E189 L190 A191 Q192 E193 F194 K196 P23 Y27 E41 L42 A43 Q44 E45 F46 K48
BS03 peptide 1C Y155 V183 Y14 V35
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0008137 NADH dehydrogenase (ubiquinone) activity
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0032981 mitochondrial respiratory chain complex I assembly
GO:0072593 reactive oxygen species metabolic process
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016604 nuclear body
GO:0031966 mitochondrial membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ugp, PDBe:8ugp, PDBj:8ugp
PDBsum8ugp
PubMed38811722
UniProtA0A286ZNN4

[Back to BioLiP]