Structure of PDB 6qx9 Chain 1C

Receptor sequence
>6qx91C (length=50) Species: 9606 (Homo sapiens) [Search protein sequence]
PKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLID
3D structure
PDB6qx9 Mechanism of 5' splice site transfer for human spliceosome activation.
Chain1C
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1C P2 K3 H15 S17 S19 V20 K29 P1 K2 H14 S16 S18 V19 K28
BS02 rna 1C T11 Y12 T14 H24 R28 T10 Y11 T13 H23 R27
BS03 ZN 1C C6 H24 H30 C5 H23 H29
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003727 single-stranded RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0030619 U1 snRNA binding
GO:0030627 pre-mRNA 5'-splice site binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0015030 Cajal body
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qx9, PDBe:6qx9, PDBj:6qx9
PDBsum6qx9
PubMed30975767
UniProtP09234|RU1C_HUMAN U1 small nuclear ribonucleoprotein C (Gene Name=SNRPC)

[Back to BioLiP]