Structure of PDB 6qx9 Chain 1A

Receptor sequence

>6qx91A (length=98) Species: 9606 (Homo sapiens)

TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVE

3D structure

• PDB: 6qx9 Mechanism of 5' splice site transfer for human spliceosome activation.
• Chain: 1A
• Resolution: 3.28 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1A	Y13 N15 N16 E19 S48 L49 K50 M51 R52 Q54 F56 K80 Q85 K88 D90 S91 D92	Y8 N10 N11 E14 S43 L44 K45 M46 R47 Q49 F51 K75 Q80 K83 D85 S86 D87

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030619 U1 snRNA binding
• GO:0042802 identical protein binding
• GO:1990446 U1 snRNP binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005685 U1 snRNP
• GO:0030532 small nuclear ribonucleoprotein complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex

External links

• PDB: RCSB:6qx9, PDBe:6qx9, PDBj:6qx9
• PDBsum: 6qx9
• PubMed: 30975767
• UniProt: P09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)