Structure of PDB 4wzo Chain 1A

Receptor sequence
>4wzo1A (length=66) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
FDHKTLDASAQKIVEAARRSGSGPIPLPTRVTVIRGPFKHKDSREHFEII
NPNRKTIEQLMPTGVE
3D structure
PDB4wzo Structural insights into the translational infidelity mechanism.
Chain1A
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1A H13 K14 G36 P37 I38 P39 L40 P41 T42 R43 V44 T48 R51 P53 F54 K55 H56 K57 S59 R60 H62 H3 K4 G23 P24 I25 P26 L27 P28 T29 R30 V31 T32 R35 P37 F38 K39 H40 K41 S43 R44 H46
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wzo, PDBe:4wzo, PDBj:4wzo
PDBsum4wzo
PubMed26037619
UniProtQ5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]