Structure of PDB 3j78 Chain 19

Receptor sequence

>3j7819 (length=143) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAE
GWFYKRAASVARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSIN
RKVLQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEEDE

3D structure

PDB

3j78 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	19	P2 G3 A11 Q12 K38 S41 N43 E44 M45 P47 Q48 S60 Y66 R68 G72 K75 K78 L79 Y80 G82 R86 G87 V88 R89 P90 Y91 H93 S97 G98 S99 R102 K119 R123 Q129 R130	P1 G2 A10 Q11 K37 S40 N42 E43 M44 P46 Q47 S59 Y65 R67 G71 K74 K77 L78 Y79 G81 R85 G86 V87 R88 P89 Y90 H92 S96 G97 S98 R101 K118 R122 Q128 R129

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000054	ribosomal subunit export from nucleus
GO:0006412	translation
GO:0042254	ribosome biogenesis
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j78, PDBe:3j78, PDBj:3j78
PDBsum	3j78
PubMed	25043550
UniProt	P07280\|RS19A_YEAST Small ribosomal subunit protein eS19A (Gene Name=RPS19A)