Structure of PDB 3j77 Chain 19

Receptor sequence

>3j7719 (length=143) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAE
GWFYKRAASVARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSIN
RKVLQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEEDE

3D structure

PDB

3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	19	V4 S5 R7 I15 K38 S41 E44 M45 Q48 K56 Y66 R68 K69 V73 G74 K75 K78 L79 G82 R86 G87 V88 R89 Y91 H93 G98 S99 R102 R122 R123 E126 Q129 R130 D133	V3 S4 R6 I14 K37 S40 E43 M44 Q47 K55 Y65 R67 K68 V72 G73 K74 K77 L78 G81 R85 G86 V87 R88 Y90 H92 G97 S98 R101 R121 R122 E125 Q128 R129 D132

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000054	ribosomal subunit export from nucleus
GO:0006412	translation
GO:0042254	ribosome biogenesis
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum	3j77
PubMed	25043550
UniProt	P07280\|RS19A_YEAST Small ribosomal subunit protein eS19A (Gene Name=RPS19A)