Structure of PDB 7vd5 Chain 17

Receptor sequence
>7vd517 (length=176) [Search protein sequence]
SEIELGATEPLGVFDPLGWLETEPEAFERRRAVERKHGRVAMAAVVGTIV
HNNHIVFDGYISPSNNLKFSDIPTGIDGIFSVPTAGLAQIIAFLGFVELA
WLPASQYDGDYGVGYFGNDILDPEEKARKLNAELNNGRAAMMGIMGNMVA
EKITGQTMYEQYAAGHFNPFNDGEGF
3D structure
PDB7vd5 Structural basis for different types of hetero-tetrameric light-harvesting complexes in a diatom PSII-FCPII supercomplex
Chain17
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 17 F126 A130 W131 F96 A100 W101
BS02 A86 17 F146 G147 F116 G117
BS03 CLA 17 G36 L41 F44 W49 L50 R60 R61 E64 R168 M171 M172 G6 L11 F14 W19 L20 R30 R31 E34 R138 M141 M142
BS04 KC1 17 R59 V63 H67 M175 R29 V33 H37 M145
BS05 CLA 17 A73 A74 G77 H81 I85 V86 F87 F99 I102 I109 A43 A44 G47 H51 I55 V56 F57 F69 I72 I79
BS06 KC1 17 I91 S92 P93 S94 P113 A115 G116 Q119 I120 I61 S62 P63 S64 P83 A85 G86 Q89 I90
BS07 KC1 17 V63 K66 H67 I121 G125 E128 A134 S135 Y137 V33 K36 H37 I91 G95 E98 A104 S105 Y107
BS08 CLA 17 R69 M72 G139 D140 Y141 G142 V143 G144 Y145 D149 I150 K156 K159 L160 E163 N166 R39 M42 G109 D110 Y111 G112 V113 G114 Y115 D119 I120 K126 K129 L130 E133 N136
BS09 KC1 17 Y145 R158 K159 N166 Y115 R128 K129 N136
BS10 CLA 17 M172 G173 G176 V179 Q191 P199 M142 G143 G146 V149 Q161 P169
BS11 A86 17 M72 V143 G144 Y145 F146 N166 A169 A170 G173 G176 N177 Y192 M42 V113 G114 Y115 F116 N136 A139 A140 G143 G146 N147 Y162
BS12 A86 17 F44 P46 H67 A74 G105 I106 I109 M171 M172 I174 F14 P16 H37 A44 G75 I76 I79 M141 M142 I144
BS13 A86 17 N165 A169 N135 A139
BS14 A86 17 W49 E53 R60 K182 W19 E23 R30 K152
BS15 A86 17 K66 V70 Y90 I91 I120 L124 E128 K36 V40 Y60 I61 I90 L94 E98
BS16 A86 17 I79 N83 Y145 Y192 I49 N53 Y115 Y162
BS17 A86 17 Y189 Y192 A193 Y159 Y162 A163
BS18 CLA 17 E39 P40 R158 N161 A162 N165 N166 E9 P10 R128 N131 A132 N135 N136
BS19 CLA 17 G125 F126 L129 G95 F96 L99
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 01:27:34 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7vd5', asym_id = '17', title = 'Structural basis for different types of hetero-t...ing complexes in a diatom PSII-FCPII supercomplex'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7vd5', asym_id='17', title='Structural basis for different types of hetero-t...ing complexes in a diatom PSII-FCPII supercomplex')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009765,0016020', uniprot = '', pdbid = '7vd5', asym_id = '17'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009765,0016020', uniprot='', pdbid='7vd5', asym_id='17')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>