Structure of PDB 8vtv Chain 16

Receptor sequence
>8vtv16 (length=53) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE
VKI
3D structure
PDB8vtv Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.
Chain16
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 16 A2 S3 R6 K8 R18 R19 Y21 T23 E24 N26 N29 L34 L36 R37 K38 Y39 R44 H46 I54 A1 S2 R5 K7 R17 R18 Y20 T22 E23 N25 N28 L33 L35 R36 K37 Y38 R43 H45 I53
BS02 MG 16 K38 Y39 K37 Y38
BS03 MG 16 E51 V52 K53 E50 V51 K52
BS04 ZN 16 C13 C16 C40 C43 C12 C15 C39 C42
External links
PDB RCSB:8vtv, PDBe:8vtv, PDBj:8vtv
PDBsum8vtv
PubMed39039256
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]