Structure of PDB 8t8b Chain 16

Receptor sequence
>8t8b16 (length=53) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE
VKI
3D structure
PDB8t8b Practical Synthesis of N -Formylmethionylated Peptidyl-tRNA Mimics.
Chain16
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 16 A2 S3 R6 R18 R19 Y21 T23 E24 N26 N29 T30 L34 L36 R37 K38 Y39 W42 R44 K45 H46 I54 A1 S2 R5 R17 R18 Y20 T22 E23 N25 N28 T29 L33 L35 R36 K37 Y38 W41 R43 K44 H45 I53
BS02 ZN 16 C13 C16 C40 C43 C12 C15 C39 C42
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8t8b, PDBe:8t8b, PDBj:8t8b
PDBsum8t8b
PubMed37433044
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]