Structure of PDB 7jqm Chain 16

Receptor sequence

>7jqm16 (length=53) Species: 300852 (Thermus thermophilus HB8)

ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE
VKI

3D structure

• PDB: 7jqm Peptide Inhibitors of Bacterial Protein Synthesis with Broad Spectrum and SbmA-Independent Bactericidal Activity against Clinical Pathogens.
• Chain: 16
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	16	A2 S3 R6 K8 R18 Y21 A22 T23 E24 N29 T30 L34 L36 R37 K38 Y39 W42 R44 H46 I54	A1 S2 R5 K7 R17 Y20 A21 T22 E23 N28 T29 L33 L35 R36 K37 Y38 W41 R43 H45 I53
BS02	ZN	16	C13 C16 C40 C43	C12 C15 C39 C42

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7jqm, PDBe:7jqm, PDBj:7jqm
• PDBsum: 7jqm
• PubMed: 32787108
• UniProt: P35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)