Structure of PDB 6cfl Chain 16

Receptor sequence

>6cfl16 (length=53) Species: 300852 (Thermus thermophilus HB8)

ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE
VKI

3D structure

• PDB: 6cfl Binding and Action of Amino Acid Analogs of Chloramphenicol upon the Bacterial Ribosome.
• Chain: 16
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	16	A2 S3 R6 R18 Y21 T23 E24 N26 N29 L36 R37 K38 Y39 R44 H46 I54	A1 S2 R5 R17 Y20 T22 E23 N25 N28 L35 R36 K37 Y38 R43 H45 I53
BS02	ZN	16	C13 C16 C40 C43	C12 C15 C39 C42

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6cfl, PDBe:6cfl, PDBj:6cfl
• PDBsum: 6cfl
• PubMed: 29410130
• UniProt: P35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)