Structure of PDB 3j6x Chain 16

Receptor sequence

>3j6x16 (length=141) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]

AVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPL
LLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR

3D structure

PDB

3j6x Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.

Chain

Resolution

6.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	16	F10 K14 S15 V19 E40 E42 R68 G71 G72 G73 H74 V75 S76 Q77 S121 R122 R123 P124 E125 P126 K127 K128 F129 G133 R135 S136 F138 Q139 K140 S141 Y142 R143	F8 K12 S13 V17 E38 E40 R66 G69 G70 G71 H72 V73 S74 Q75 S119 R120 R121 P122 E123 P124 K125 K126 F127 G131 R133 S134 F136 Q137 K138 S139 Y140 R141

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation
GO:0006413	translational initiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j6x, PDBe:3j6x, PDBj:3j6x
PDBsum	3j6x
PubMed	24927574
UniProt	P0CX51\|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)