Structure of PDB 3j6x Chain 15

Receptor sequence
>3j6x15 (length=124) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
KKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFM
KKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEI
RPEMLGHYLGEFSITYTPVRHGRA
3D structure
PDB3j6x Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
Chain15
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 15 R18 A39 R40 R42 R43 R44 R47 A54 K59 R77 H79 R81 N82 Y97 G99 Y115 T122 T124 V126 R127 H128 R11 A32 R33 R35 R36 R37 R40 A47 K52 R70 H72 R74 N75 Y90 G92 Y108 T115 T117 V119 R120 H121
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6x, PDBe:3j6x, PDBj:3j6x
PDBsum3j6x
PubMed24927574
UniProtQ01855|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]