Structure of PDB 8cvj Chain 14

Receptor sequence
>8cvj14 (length=69) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV
DTEGRVERFQRRYGDSYRK
3D structure
PDB8cvj Insights into the ribosome function from the structures of non-arrested ribosome-nascent chain complexes.
Chain14
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 14 M1 K2 H6 M1 K2 H6
BS02 ZN 14 C16 C18 C36 C39 C16 C18 C36 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cvj, PDBe:8cvj, PDBj:8cvj
PDBsum8cvj
PubMed36316410
UniProtQ5SJE1|RL31_THET8 Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]