Structure of PDB 3j6x Chain 14

Receptor sequence

>3j6x14 (length=127) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]

SQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGL
RIGRIEDVTPVPSDSTRKKGGRRGRRL

3D structure

PDB

3j6x Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.

Chain

Resolution

6.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	14	N24 D25 F27 H29 G35 K36 E37 T38 R41 T43 M46 A50 D51 R52 E54 R90 P120 V121 P122 S123 D124 S125 R127 K129 R132 R133 R135 R136 L137	N14 D15 F17 H19 G25 K26 E27 T28 R31 T33 M36 A40 D41 R42 E44 R80 P110 V111 P112 S113 D114 S115 R117 K119 R122 R123 R125 R126 L127

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j6x, PDBe:3j6x, PDBj:3j6x
PDBsum	3j6x
PubMed	24927574
UniProt	P06367\|RS14A_YEAST Small ribosomal subunit protein uS11A (Gene Name=RPS14A)