Structure of PDB 8uvs Chain 13

Receptor sequence
>8uvs13 (length=59) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVA
HLVRVEVVE
3D structure
PDB8uvs Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.
Chain13
Resolution2.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 13 K10 S11 I13 G14 P16 K17 A21 A22 K24 A25 R29 R30 L31 Q32 P41 A42 G45 N46 K49 K9 S10 I12 G13 P15 K16 A20 A21 K23 A24 R28 R29 L30 Q31 P40 A41 G44 N45 K48
BS02 rna 13 Y15 Q19 H52 Y14 Q18 H51
BS03 MG 13 R30 L31 R29 L30
BS04 MG 13 K10 S11 Y15 K9 S10 Y14
BS05 MG 13 L31 Q32 Q33 L30 Q31 Q32
External links
PDB RCSB:8uvs, PDBe:8uvs, PDBj:8uvs
PDBsum8uvs
PubMed38165935
UniProtQ5SHQ6|RL30_THET8 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]