Structure of PDB 8fnk Chain 13 |
>8fnk13 (length=127) Species: 5691 (Trypanosoma brucei) [Search protein sequence] |
NPWNDGDAGWRGAATGARANRGRGGFRRGRQRVQVSGLSDETTWHTLKDH LRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLRED REDTVLVNTRRKIREVRDAQLRARKEE |
|
PDB | 8fnk Structural basis of gRNA stabilization and mRNA recognition in trypanosomal RNA editing. |
Chain | 13 |
Resolution | 3.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
13 |
R131 W205 |
R23 W44 |
|
|
|
|