Structure of PDB 7vd5 Chain 13

Receptor sequence

>7vd513 (length=169)

SEIELGVTEPLGVYDPLGWLESEPEAFERRRAVERKHGRVAMAAVVGTIV
HNNHIVFDGYLSPSNNLKFSDIPTGVDGIRAIPTAGLAQILAFFALVELA
WMPASKYDGDYGVGYFGTDIKDPEEKARKLNVELNNGRAAMMGIMGNMVA
EVLTGQTMYEQYASGHISP

3D structure

• PDB: 7vd5 Structural basis for different types of hetero-tetrameric light-harvesting complexes in a diatom PSII-FCPII supercomplex
• Chain: 13
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	13	A130 W131 M132	A100 W101 M102
BS02	A86	13	F146 G147	F116 G117
BS03	A86	13	K66 V70 Y90 L91 I120 F124 E128	K36 V40 Y60 L61 I90 F94 E98
BS04	CLA	13	Y44 D45 W49 L50 R60 R61 E64 H67 R168 M171 M172	Y14 D15 W19 L20 R30 R31 E34 H37 R138 M141 M142
BS05	KC1	13	R59 H67 M175	R29 H37 M145
BS06	CLA	13	A73 A74 G77 H81 V86 F87 F99 I102 G108	A43 A44 G47 H51 V56 F57 F69 I72 G78
BS07	KC1	13	L91 S92 A115 G116 Q119 I120 F123	L61 S62 A85 G86 Q89 I90 F93
BS08	CLA	13	I109 R110 M178	I79 R80 M148
BS09	KC1	13	R59 A62 V63 K66 H67 V70 A125 E128 L129 A134 Y137	R29 A32 V33 K36 H37 V40 A95 E98 L99 A104 Y107
BS10	CLA	13	R69 M72 G139 D140 Y141 V143 G144 Y145 D149 K159 L160 E163	R39 M42 G109 D110 Y111 V113 G114 Y115 D119 K129 L130 E133
BS11	CLA	13	P40 V162 N165 N166	P10 V132 N135 N136
BS12	KC1	13	V76 R158 K159 V162 N166	V46 R128 K129 V132 N136
BS13	CLA	13	M172 G176 V179 I197 P199	M142 G146 V149 I167 P169
BS14	A86	13	M72 M132 V143 G144 Y145 F146 N166 A169 A170 G173 N177 Y192	M42 M102 V113 G114 Y115 F116 N136 A139 A140 G143 N147 Y162
BS15	A86	13	Y44 P46 A74 I109 M171 I174 M175	Y14 P16 A44 I79 M141 I144 M145
BS16	A86	13	L41 N165 A169 M172	L11 N135 A139 M142
BS17	A86	13	W49 E53 V182	W19 E23 V152
BS18	A86	13	N83 Y145 Y192	N53 Y115 Y162
BS19	A86	13	Y189 Y192 A193	Y159 Y162 A163

Gene Ontology

Biological Process

• GO:0009765 photosynthesis, light harvesting

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:7vd5, PDBe:7vd5, PDBj:7vd5
• PDBsum: 7vd5
• UniProt: A0A679BXP6