Structure of PDB 6nd6 Chain 13

Receptor sequence

>6nd613 (length=59) Species: 300852 (Thermus thermophilus HB8)

PRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVA
HLVRVEVVE

3D structure

• PDB: 6nd6 High-resolution crystal structures of ribosome-bound chloramphenicol and erythromycin provide the ultimate basis for their competition.
• Chain: 13
• Resolution: 2.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	13	K10 S11 I13 G14 Y15 P16 K17 D18 A21 A22 K24 A25 R29 L31 Q32 P41 A42 G45 N46 K49	K9 S10 I12 G13 Y14 P15 K16 D17 A20 A21 K23 A24 R28 L30 Q31 P40 A41 G44 N45 K48
BS02	rna	13	Q19 H52	Q18 H51
BS03	MG	13	K10 S11	K9 S10
BS04	MG	13	R30 L31 Q32 Q33	R29 L30 Q31 Q32

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6nd6, PDBe:6nd6, PDBj:6nd6
• PDBsum: 6nd6
• PubMed: 30733327
• UniProt: Q5SHQ6|RL30_THET8 Large ribosomal subunit protein uL30 (Gene Name=rpmD)