Structure of PDB 8cvj Chain 12

Receptor sequence
>8cvj12 (length=70) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKI
RDLKRQIARLLTVLNEKRRQ
3D structure
PDB8cvj Insights into the ribosome function from the structures of non-arrested ribosome-nascent chain complexes.
Chain12
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 12 M1 K2 R7 L10 R14 S45 Q46 N47 H48 R51 R55 A58 R59 L61 T62 N65 R69 M1 K2 R7 L10 R14 S45 Q46 N47 H48 R51 R55 A58 R59 L61 T62 N65 R69
BS02 MG 12 K54 I57 K54 I57
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cvj, PDBe:8cvj, PDBj:8cvj
PDBsum8cvj
PubMed36316410
UniProtQ5SHP6|RL29_THET8 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]