Structure of PDB 3j6y Chain 12

Receptor sequence
>3j6y12 (length=124) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
AEVTIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSSVTEA
NIIKLVEGLANDPENKVPLIKVADAKQLGEWAGLGKIDREGNARKVVGAS
VVVVKNWGAETDELSMIMEHFSQQ
3D structure
PDB3j6y Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
Chain12
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 12 R43 G44 L45 R46 E47 V66 T67 L103 K114 V116 G117 A118 R24 G25 L26 R27 E28 V47 T48 L84 K95 V97 G98 A99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:0042274 ribosomal small subunit biogenesis
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6y, PDBe:3j6y, PDBj:3j6y
PDBsum3j6y
PubMed24927574
UniProtP48589|RS12_YEAST Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]