Structure of PDB 9b00 Chain 11

Receptor sequence

>9b0011 (length=97) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

PDB

9b00 Berberine analog of chloramphenicol exhibits a distinct mode of action and unveils ribosome plasticity.

Chain

Resolution

2.8 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	11	S2 K3 K10 I13 A15 N16 R20 R21 A24 K25 G28 G29 V30 G31 K32 K33 T34 T35 I37 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 R61 A64 H66 K69 R76 G79	S1 K2 K9 I12 A14 N15 R19 R20 A23 K24 G27 G28 V29 G30 K31 K32 T33 T34 I36 K38 R39 R40 Q41 Y42 P43 N44 Q46 R49 R51 R60 A63 H65 K68 R75 G78
BS02	rna	11	K23 V30	K22 V29
BS03	MG	11	R20 K32 K33 T34	R19 K31 K32 T33
BS04	MG	11	Q47 K48	Q46 K47

External links

PDB	RCSB:9b00, PDBe:9b00, PDBj:9b00
PDBsum	9b00
PubMed	39019034
UniProt	P60494\|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)