Structure of PDB 8vtw Chain 11

Receptor sequence

>8vtw11 (length=97) Species: 300852 (Thermus thermophilus HB8)

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

• PDB: 8vtw Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.
• Chain: 11
• Resolution: 2.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	11	S2 K3 K10 I13 A15 N16 Q19 R20 R21 A24 K25 G28 G29 V30 G31 K32 K33 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 G55 R61 H66 K69 R76 G79 K81 K92	S1 K2 K9 I12 A14 N15 Q18 R19 R20 A23 K24 G27 G28 V29 G30 K31 K32 T33 T34 K38 R39 R40 Q41 Y42 P43 N44 Q46 R49 R51 G54 R60 H65 K68 R75 G78 K80 K91
BS02	MG	11	A24 K25 R26	A23 K24 R25

External links

• PDB: RCSB:8vtw, PDBe:8vtw, PDBj:8vtw
• PDBsum: 8vtw
• PubMed: 39039256
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)