Structure of PDB 8g2b Chain 11

Receptor sequence

>8g2b11 (length=97) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

PDB

8g2b Structural basis of Cfr-mediated antimicrobial resistance and mechanisms to evade it

Chain

Resolution

2.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	11	S2 K3 K10 R11 I13 V14 A15 N16 I18 Q19 R20 R21 A24 K25 G28 G29 V30 G31 K32 K33 T34 T35 I37 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 R61 H66 K69 R76 G79	S1 K2 K9 R10 I12 V13 A14 N15 I17 Q18 R19 R20 A23 K24 G27 G28 V29 G30 K31 K32 T33 T34 I36 K38 R39 R40 Q41 Y42 P43 N44 Q46 R49 R51 R60 H65 K68 R75 G78
BS02	MG	11	R20 K32 K33 T34	R19 K31 K32 T33

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8g2b, PDBe:8g2b, PDBj:8g2b
PDBsum	8g2b
PubMed	38238495
UniProt	P60494\|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)