Structure of PDB 6ywe Chain 11

Receptor sequence
>6ywe11 (length=88) Species: 5141 (Neurospora crassa) [Search protein sequence]
PNKPIRLPPLKQLRVRQANKAEENPCIAVMSSVLACWASAGYNSAGCATV
ENALRACMDAPKPAPKPNNTINYHLSRFQERLTQGKSK
3D structure
PDB6ywe Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
Chain11
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 11 K4 P10 L11 Q13 L14 R15 V16 R17 K21 N69 N70 T71 I72 N73 Y74 Q85 K3 P9 L10 Q12 L13 R14 V15 R16 K20 N68 N69 T70 I71 N72 Y73 Q84
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 17 04:54:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6ywe', asym_id = '11', title = 'Analysis of translating mitoribosome reveals fun...eristics of translation in mitochondria of fungi.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6ywe', asym_id='11', title='Analysis of translating mitoribosome reveals fun...eristics of translation in mitochondria of fungi.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0032543', uniprot = '', pdbid = '6ywe', asym_id = '11'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0032543', uniprot='', pdbid='6ywe', asym_id='11')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>