Structure of PDB 6yw5 Chain 11

Receptor sequence
>6yw511 (length=88) Species: 367110 (Neurospora crassa OR74A) [Search protein sequence]
PNKPIRLPPLKQLRVRQANKAEENPCIAVMSSVLACWASAGYNSAGCATV
ENALRACMDAPKPAPKPNNTINYHLSRFQERLTQGKSK
3D structure
PDB6yw5 Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
Chain11
Resolution2.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 11 N3 K4 P10 L11 Q13 L14 R15 V16 R17 A19 K21 N70 T71 N73 Y74 H75 Q85 N2 K3 P9 L10 Q12 L13 R14 V15 R16 A18 K20 N69 T70 N72 Y73 H74 Q84
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yw5, PDBe:6yw5, PDBj:6yw5
PDBsum6yw5
PubMed33056988
UniProtQ7S4Y4|MRP10_NEUCR Small ribosomal subunit protein mS37 (Gene Name=mrp10)

[Back to BioLiP]