Structure of PDB 8vty Chain 10

Receptor sequence

>8vty10 (length=77) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

GSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDF
TLFALVDGVVEFQDRGRLGRYVHVRPL

3D structure

PDB

8vty Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.6 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	10	S9 N12 R14 D15 S16 Q17 A18 K19 R20 K24 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 G54 R55 D56 F57 F60 F69 R74 R77	S2 N5 R7 D8 S9 Q10 A11 K12 R13 K17 Y19 E20 Q22 R25 A26 G27 N28 I29 R32 R34 G35 T36 G47 R48 D49 F50 F53 F62 R67 R70
BS02	rna	10	R72 G73 R74	R65 G66 R67
BS03	MG	10	G22 V23	G15 V16
BS04	MG	10	Q17 A18	Q10 A11
BS05	MG	10	T10 R11	T3 R4

External links

PDB	RCSB:8vty, PDBe:8vty, PDBj:8vty
PDBsum	8vty
PubMed	39039256
UniProt	P60493\|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)