Structure of PDB 8fc4 Chain 10

Receptor sequence

>8fc410 (length=77) Species: 300852 (Thermus thermophilus HB8)

GSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDF
TLFALVDGVVEFQDRGRLGRYVHVRPL

3D structure

• PDB: 8fc4 Structural insights into the mechanism of overcoming Erm-mediated resistance by macrolides acting together with hygromycin-A.
• Chain: 10
• Resolution: 2.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	10	S9 T10 N12 R14 D15 S16 Q17 A18 K19 R20 K24 R25 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 G54 R55 D56 F57 F60 F69 R74 L75 R77	S2 T3 N5 R7 D8 S9 Q10 A11 K12 R13 K17 R18 Y19 E20 Q22 R25 A26 G27 N28 I29 R32 R34 G35 T36 G47 R48 D49 F50 F53 F62 R67 L68 R70
BS02	rna	10	R72 G73 R74 L75	R65 G66 R67 L68
BS03	MG	10	G22 V23	G15 V16
BS04	MG	10	Q17 A18	Q10 A11

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fc4, PDBe:8fc4, PDBj:8fc4
• PDBsum: 8fc4
• PubMed: 37452045
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)