Structure of PDB 9fmd Chain 1

Receptor sequence
>9fmd1 (length=123) Species: 9606 (Homo sapiens) [Search protein sequence]
TLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMG
SSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKRLEKNKIA
AEEQTAKRRKKRQKLKEKKLLAK
3D structure
PDB9fmd Mechanism for the initiation of spliceosome disassembly.
Chain1
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 T20 L21 I23 L33 R37 D66 G77 H80 V81 H84 T124 R127 R128 R131 K133 K135 K137 K138 K142 T1 L2 I4 L14 R18 D47 G58 H61 V62 H65 T105 R108 R109 R112 K114 K116 K118 K119 K123
BS02 rna 1 A72 G73 S76 A53 G54 S57
Gene Ontology
Molecular Function
GO:0003725 double-stranded RNA binding
GO:0004860 protein kinase inhibitor activity
GO:0005515 protein binding
GO:0019901 protein kinase binding
Biological Process
GO:0003014 renal system process
GO:0006397 mRNA processing
GO:0006469 negative regulation of protein kinase activity
GO:0008380 RNA splicing
GO:0042326 negative regulation of phosphorylation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005730 nucleolus
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9fmd, PDBe:9fmd, PDBj:9fmd
PDBsum9fmd
PubMed38925148
UniProtQ9H875|PKRI1_HUMAN PRKR-interacting protein 1 (Gene Name=PRKRIP1)

[Back to BioLiP]